From patchwork Fri Apr 16 12:28:43 2021 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Richard Haines X-Patchwork-Id: 12207533 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org X-Spam-Level: X-Spam-Status: No, score=-18.7 required=3.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,HEADER_FROM_DIFFERENT_DOMAINS,INCLUDES_CR_TRAILER, INCLUDES_PATCH,MAILING_LIST_MULTI,SPF_HELO_NONE,SPF_PASS,URIBL_BLOCKED, USER_AGENT_GIT autolearn=ham autolearn_force=no version=3.4.0 Received: from mail.kernel.org (mail.kernel.org [198.145.29.99]) by smtp.lore.kernel.org (Postfix) with ESMTP id 82FBFC43462 for ; Fri, 16 Apr 2021 12:28:57 +0000 (UTC) Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by mail.kernel.org (Postfix) with ESMTP id 412B76117A for ; Fri, 16 Apr 2021 12:28:57 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S234914AbhDPM3U (ORCPT ); Fri, 16 Apr 2021 08:29:20 -0400 Received: from mailomta18-re.btinternet.com ([213.120.69.111]:60384 "EHLO re-prd-fep-047.btinternet.com" rhost-flags-OK-OK-OK-FAIL) by vger.kernel.org with ESMTP id S243527AbhDPM3U (ORCPT ); Fri, 16 Apr 2021 08:29:20 -0400 Received: from re-prd-rgout-002.btmx-prd.synchronoss.net ([10.2.54.5]) by re-prd-fep-047.btinternet.com with ESMTP id <20210416122854.PEFS28099.re-prd-fep-047.btinternet.com@re-prd-rgout-002.btmx-prd.synchronoss.net>; Fri, 16 Apr 2021 13:28:54 +0100 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=btinternet.com; s=btmx201904; t=1618576134; bh=oGwdww20lPkRlXZQIZge0EjDW+p1WNJJy58pUottT7U=; h=From:To:Cc:Subject:Date:Message-Id:X-Mailer:In-Reply-To:References:MIME-Version; b=V4GKZi4Nn8QVVHMAsucUIGQVcnDBbghUKcWbBobdp2jdMCVjaqwJZlhUYXAxW0WSwIZzf4r0aqp2ZEV4wsENuHcKhHKqNCuqDNfPIVG3p6uUlPVzxpMReot/RQfufXKSf3+U8x8JK+ACQBKY8s4bdYsdyJPepmgvWOJdeYp+NfOCSKXpmAGQ7/dCP6fgqu6g6dy6nwJjCPwFRBz4R62Z2OcCOfdWAbFs5o4R9JCRcCjgKYCYIqh9rs+dE9OwniUoYY8kegWKrF+67+7514mW0F2skQ7/gSEJdylWegGgJzEQomyqmGGmUepngAbZJk/9FClAS86sdv0q8rzmSQkudQ== Authentication-Results: btinternet.com; none X-SNCR-Rigid: 5ED9C0CC2F24872B X-Originating-IP: [86.184.99.58] X-OWM-Source-IP: 86.184.99.58 (GB) X-OWM-Env-Sender: richard_c_haines@btinternet.com X-VadeSecure-score: verdict=clean score=0/300, class=clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduledrudelhedgheefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffopdfqfgfvnecuuegrihhlohhuthemuceftddunecunecujfgurhephffvufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpeftihgthhgrrhguucfjrghinhgvshcuoehrihgthhgrrhgupggtpghhrghinhgvshessghtihhnthgvrhhnvghtrdgtohhmqeenucggtffrrghtthgvrhhnpeeutddtleelheeugefgiefhiedtheeukeffveeitdffgeffieeugeeljeegvefgieenucfkphepkeeirddukeegrdelledrheeknecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehhvghloheplhhotggrlhhhohhsthdrlhhotggrlhguohhmrghinhdpihhnvghtpeekiedrudekgedrleelrdehkedpmhgrihhlfhhrohhmpeeorhhitghhrghruggptggphhgrihhnvghssegsthhinhhtvghrnhgvthdrtghomheqpdhrtghpthhtohepoegtrghsvgihsehstghhrghufhhlvghrqdgtrgdrtghomheqpdhrtghpthhtohepoegtohhrsggvtheslhifnhdrnhgvtheqpdhrtghpthhtohepoehjmhhorhhrihhssehnrghmvghirdhorhhgqedprhgtphhtthhopeeolhhinhhugidqughotgesvhhgvghrrdhkvghrnhgvlhdrohhrgheqpdhrtghpthhtohepoehlihhnuhigqdhsvggtuhhrihhthidqmhhoughulhgvsehvghgvrhdrkhgvrhhnvghl rdhorhhgqedprhgtphhtthhopeeophgruhhlsehprghulhdqmhhoohhrvgdrtghomheqpdhrtghpthhtohepoehrihgthhgrrhgupggtpghhrghinhgvshessghtihhnthgvrhhnvghtrdgtohhmqecuqfftvefrvfeprhhftgekvddvnehrihgthhgrrhgupggtpghhrghinhgvshessghtihhnthgvrhhnvghtrdgtohhmpdhrtghpthhtohepoehsvghrghgvsehhrghllhihnhdrtghomheq X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean X-SNCR-hdrdom: btinternet.com Received: from localhost.localdomain (86.184.99.58) by re-prd-rgout-002.btmx-prd.synchronoss.net (5.8.340) (authenticated as richard_c_haines@btinternet.com) id 5ED9C0CC2F24872B; Fri, 16 Apr 2021 13:28:54 +0100 From: Richard Haines To: linux-security-module@vger.kernel.org, linux-doc@vger.kernel.org Cc: corbet@lwn.net, paul@paul-moore.com, jmorris@namei.org, serge@hallyn.com, casey@schaufler-ca.com, Richard Haines Subject: [PATCH 3/3] include/linux: Update LSM hook text part2 Date: Fri, 16 Apr 2021 13:28:43 +0100 Message-Id: <20210416122843.4752-4-richard_c_haines@btinternet.com> X-Mailer: git-send-email 2.30.2 In-Reply-To: <20210416122843.4752-1-richard_c_haines@btinternet.com> References: <20210416122843.4752-1-richard_c_haines@btinternet.com> MIME-Version: 1.0 Precedence: bulk List-ID: No hook definitions have been updated, only formatting to render in kernel_docs. Signed-off-by: Richard Haines --- include/linux/lsm_hooks.h | 1192 +++++++++++++++++++++---------------- 1 file changed, 683 insertions(+), 509 deletions(-) diff --git a/include/linux/lsm_hooks.h b/include/linux/lsm_hooks.h index b7fdab1e9..75f97c5b9 100644 --- a/include/linux/lsm_hooks.h +++ b/include/linux/lsm_hooks.h @@ -950,71 +950,79 @@ * * @sig contains the signal value. * * @cred contains the cred of the process where the signal originated, or %NULL if the current task is the originator. * * Return %0 if permission is granted. - * @task_prctl: + * + * int task_prctl(int option, unsigned long arg2, unsigned long arg3, unsigned long arg4, unsigned long arg5) * Check permission before performing a process control operation on the * current process. - * @option contains the operation. - * @arg2 contains a argument. - * @arg3 contains a argument. - * @arg4 contains a argument. - * @arg5 contains a argument. - * Return -ENOSYS if no-one wanted to handle this op, any other value to - * cause prctl() to return immediately with that value. - * @task_to_inode: + * + * * @option contains the operation. + * * @arg2 contains a argument. + * * @arg3 contains a argument. + * * @arg4 contains a argument. + * * @arg5 contains a argument. + * * Return %-ENOSYS if no-one wanted to handle this op, any other value to cause @prctl() to return immediately with that value. + * + * void task_to_inode(struct task_struct \*p, struct inode \*inode) * Set the security attributes for an inode based on an associated task's * security attributes, e.g. for /proc/pid inodes. - * @p contains the task_struct for the task. - * @inode contains the inode structure for the inode. * - * Security hooks for Netlink messaging. + * * @p contains the task_struct for the task. + * * @inode contains the inode structure for the inode. + * + * **Security hooks for Netlink messaging:** * - * @netlink_send: + * int netlink_send(struct sock \*sk, struct sk_buff \*skb) * Save security information for a netlink message so that permission * checking can be performed when the message is processed. The security - * information can be saved using the eff_cap field of the - * netlink_skb_parms structure. Also may be used to provide fine + * information can be saved using the %eff_cap field of the + * @netlink_skb_parms structure. Also may be used to provide fine * grained control over message transmission. - * @sk associated sock of task sending the message. - * @skb contains the sk_buff structure for the netlink message. - * Return 0 if the information was successfully saved and message - * is allowed to be transmitted. * - * Security hooks for Unix domain networking. + * * @sk associated sock of task sending the message. + * * @skb contains the sk_buff structure for the netlink message. + * * Return %0 if the information was successfully saved and message is allowed to be transmitted. * - * @unix_stream_connect: + * **Security hooks for Unix domain networking:** + * + * int unix_stream_connect(struct sock \*sock, struct sock \*other, struct sock \*newsk) * Check permissions before establishing a Unix domain stream connection * between @sock and @other. - * @sock contains the sock structure. - * @other contains the peer sock structure. - * @newsk contains the new sock structure. - * Return 0 if permission is granted. - * @unix_may_send: + * + * * @sock contains the sock structure. + * * @other contains the peer sock structure. + * * @newsk contains the new sock structure. + * * Return %0 if permission is granted. + * + * int unix_may_send(struct socket \*sock, struct socket \*other) * Check permissions before connecting or sending datagrams from @sock to * @other. - * @sock contains the socket structure. - * @other contains the peer socket structure. - * Return 0 if permission is granted. * - * The @unix_stream_connect and @unix_may_send hooks were necessary because + * * @sock contains the socket structure. + * * @other contains the peer socket structure. + * * Return %0 if permission is granted. + * + * The @unix_stream_connect() and @unix_may_send() hooks were necessary because * Linux provides an alternative to the conventional file name space for Unix * domain sockets. Whereas binding and connecting to sockets in the file name - * space is mediated by the typical file permissions (and caught by the mknod - * and permission hooks in inode_security_ops), binding and connecting to + * space is mediated by the typical file permissions (and caught by the @mknod + * and permission hooks in @inode_security_ops()), binding and connecting to * sockets in the abstract name space is completely unmediated. Sufficient * control of Unix domain sockets in the abstract name space isn't possible * using only the socket layer hooks, since we need to know the actual target - * socket, which is not looked up until we are inside the af_unix code. + * socket, which is not looked up until we are inside the @af_unix code. * - * Security hooks for socket operations. + * **Security hooks for socket operations:** * - * @socket_create: + * int socket_create(int family, int type, int protocol, int kern) * Check permissions prior to creating a new socket. - * @family contains the requested protocol family. - * @type contains the requested communications type. - * @protocol contains the requested protocol. - * @kern set to 1 if a kernel socket. - * Return 0 if permission is granted. - * @socket_post_create: + * + * * @family contains the requested protocol family. + * * @type contains the requested communications type. + * * @protocol contains the requested protocol. + * * @kern set to %1 if a kernel socket. + * * Return %0 if permission is granted. + * + * int socket_post_create(struct socket \*sock, int family, int type, int protocol, int kern) * This hook allows a module to update or allocate a per-socket security * structure. Note that the security field was not added directly to the * socket structure, but rather, the socket security information is stored @@ -1023,706 +1031,872 @@ * SOCK_INODE(sock)->i_security. This hook may be used to update the * SOCK_INODE(sock)->i_security field with additional information that * wasn't available when the inode was allocated. - * @sock contains the newly created socket structure. - * @family contains the requested protocol family. - * @type contains the requested communications type. - * @protocol contains the requested protocol. - * @kern set to 1 if a kernel socket. - * @socket_socketpair: + * + * * @sock contains the newly created socket structure. + * * @family contains the requested protocol family. + * * @type contains the requested communications type. + * * @protocol contains the requested protocol. + * * @kern set to %1 if a kernel socket. + * + * int socket_socketpair(struct socket \*socka, struct socket \*sockb) * Check permissions before creating a fresh pair of sockets. - * @socka contains the first socket structure. - * @sockb contains the second socket structure. - * Return 0 if permission is granted and the connection was established. - * @socket_bind: + * + * * @socka contains the first socket structure. + * * @sockb contains the second socket structure. + * * Return %0 if permission is granted and the connection was established. + * + * int socket_bind(struct socket \*sock, struct sockaddr \*address, int addrlen) * Check permission before socket protocol layer bind operation is * performed and the socket @sock is bound to the address specified in the * @address parameter. - * @sock contains the socket structure. - * @address contains the address to bind to. - * @addrlen contains the length of address. - * Return 0 if permission is granted. - * @socket_connect: + * + * * @sock contains the socket structure. + * * @address contains the address to bind to. + * * @addrlen contains the length of address. + * * Return %0 if permission is granted. + * + * int socket_connect(struct socket \*sock, struct sockaddr \*address, int addrlen) * Check permission before socket protocol layer connect operation * attempts to connect socket @sock to a remote address, @address. - * @sock contains the socket structure. - * @address contains the address of remote endpoint. - * @addrlen contains the length of address. - * Return 0 if permission is granted. - * @socket_listen: + * + * * @sock contains the socket structure. + * * @address contains the address of remote endpoint. + * * @addrlen contains the length of address. + * * Return %0 if permission is granted. + * + * int socket_listen(struct socket \*sock, int backlog) * Check permission before socket protocol layer listen operation. - * @sock contains the socket structure. - * @backlog contains the maximum length for the pending connection queue. - * Return 0 if permission is granted. - * @socket_accept: + * + * * @sock contains the socket structure. + * * @backlog contains the maximum length for the pending connection queue. + * * Return %0 if permission is granted. + * + * int socket_accept(struct socket \*sock, struct socket \*newsock) * Check permission before accepting a new connection. Note that the new * socket, @newsock, has been created and some information copied to it, * but the accept operation has not actually been performed. - * @sock contains the listening socket structure. - * @newsock contains the newly created server socket for connection. - * Return 0 if permission is granted. - * @socket_sendmsg: + * + * * @sock contains the listening socket structure. + * * @newsock contains the newly created server socket for connection. + * * Return %0 if permission is granted. + * + * int socket_sendmsg(struct socket \*sock, struct msghdr \*msg, int size) * Check permission before transmitting a message to another socket. - * @sock contains the socket structure. - * @msg contains the message to be transmitted. - * @size contains the size of message. - * Return 0 if permission is granted. - * @socket_recvmsg: + * + * * @sock contains the socket structure. + * * @msg contains the message to be transmitted. + * * @size contains the size of message. + * * Return %0 if permission is granted. + * + * int socket_recvmsg(struct socket \*sock, struct msghdr \*msg, int size, int flags) * Check permission before receiving a message from a socket. - * @sock contains the socket structure. - * @msg contains the message structure. - * @size contains the size of message structure. - * @flags contains the operational flags. - * Return 0 if permission is granted. - * @socket_getsockname: + * + * * @sock contains the socket structure. + * * @msg contains the message structure. + * * @size contains the size of message structure. + * * @flags contains the operational flags. + * * Return %0 if permission is granted. + * + * int socket_getsockname(struct socket \*sock) * Check permission before the local address (name) of the socket object * @sock is retrieved. - * @sock contains the socket structure. - * Return 0 if permission is granted. - * @socket_getpeername: + * + * * @sock contains the socket structure. + * * Return %0 if permission is granted. + * + * int socket_getpeername(struct socket \*sock) * Check permission before the remote address (name) of a socket object + * * @sock is retrieved. * @sock contains the socket structure. - * Return 0 if permission is granted. - * @socket_getsockopt: + * Return %0 if permission is granted. + * + * int socket_getsockopt(struct socket \*sock, int level, int optname) * Check permissions before retrieving the options associated with socket * @sock. - * @sock contains the socket structure. - * @level contains the protocol level to retrieve option from. - * @optname contains the name of option to retrieve. - * Return 0 if permission is granted. - * @socket_setsockopt: + * + * * @sock contains the socket structure. + * * @level contains the protocol level to retrieve option from. + * * @optname contains the name of option to retrieve. + * * Return %0 if permission is granted. + * + * int socket_setsockopt(struct socket \*sock, int level, int optname) * Check permissions before setting the options associated with socket + * * @sock. * @sock contains the socket structure. * @level contains the protocol level to set options for. * @optname contains the name of the option to set. - * Return 0 if permission is granted. - * @socket_shutdown: + * Return %0 if permission is granted. + * + * int socket_shutdown(struct socket \*sock, int how) * Checks permission before all or part of a connection on the socket * @sock is shut down. - * @sock contains the socket structure. - * @how contains the flag indicating how future sends and receives - * are handled. - * Return 0 if permission is granted. - * @socket_sock_rcv_skb: + * + * * @sock contains the socket structure. + * * @how contains the flag indicating how future sends and receives are handled. + * * Return %0 if permission is granted. + * + * int socket_sock_rcv_skb(struct sock \*sk, struct sk_buff \*skb) * Check permissions on incoming network packets. This hook is distinct * from Netfilter's IP input hooks since it is the first time that the - * incoming sk_buff @skb has been associated with a particular socket, @sk. + * incoming @sk_buff @skb has been associated with a particular socket, @sk. * Must not sleep inside this hook because some callers hold spinlocks. - * @sk contains the sock (not socket) associated with the incoming sk_buff. - * @skb contains the incoming network data. - * @socket_getpeersec_stream: + * + * * @sk contains the sock (not socket) associated with the incoming sk_buff. + * * @skb contains the incoming network data. + * + * int socket_getpeersec_stream(struct socket \*sock, char __user \*optval, int __user \*optlen, unsigned len) * This hook allows the security module to provide peer socket security - * state for unix or connected tcp sockets to userspace via getsockopt - * SO_GETPEERSEC. For tcp sockets this can be meaningful if the + * state for unix or connected tcp sockets to userspace via @getsockopt() + * %SO_GETPEERSEC. For tcp sockets this can be meaningful if the * socket is associated with an ipsec SA. - * @sock is the local socket. - * @optval userspace memory where the security state is to be copied. - * @optlen userspace int where the module should copy the actual length - * of the security state. - * @len as input is the maximum length to copy to userspace provided - * by the caller. - * Return 0 if all is well, otherwise, typical getsockopt return - * values. - * @socket_getpeersec_dgram: + * + * * @sock is the local socket. + * * @optval userspace memory where the security state is to be copied. + * * @optlen userspace int where the module should copy the actual length of the security state. + * * @len as input is the maximum length to copy to userspace provided by the caller. + * * Return %0 if all is well, otherwise, typical @getsockopt() return values. + * + * int socket_getpeersec_dgram(struct socket \*sock, struct sk_buff \*skb, u32 \*secid) * This hook allows the security module to provide peer socket security * state for udp sockets on a per-packet basis to userspace via - * getsockopt SO_GETPEERSEC. The application must first have indicated - * the IP_PASSSEC option via getsockopt. It can then retrieve the - * security state returned by this hook for a packet via the SCM_SECURITY + * getsockopt %SO_GETPEERSEC. The application must first have indicated + * the %IP_PASSSEC option via @getsockopt(). It can then retrieve the + * security state returned by this hook for a packet via the %SCM_SECURITY * ancillary message type. - * @sock contains the peer socket. May be NULL. - * @skb is the sk_buff for the packet being queried. May be NULL. - * @secid pointer to store the secid of the packet. - * Return 0 on success, error on failure. - * @sk_alloc_security: - * Allocate and attach a security structure to the sk->sk_security field, + * + * * @sock contains the peer socket. May be %NULL. + * * @skb is the @sk_buff for the packet being queried. May be %NULL. + * * @secid pointer to store the @secid of the packet. + * * Return %0 on success, error on failure. + * + * int sk_alloc_security(struct sock \*sk, int family, gfp_t priority) + * Allocate and attach a security structure to the @sk->sk_security field, * which is used to copy security attributes between local stream sockets. - * @sk_free_security: + * + * void sk_free_security(struct sock \*sk) * Deallocate security structure. - * @sk_clone_security: + * + * void sk_clone_security(const struct sock \*sk, struct sock \*newsk) * Clone/copy security structure. - * @sk_getsecid: + * + * void sk_getsecid(struct sock \*sk, u32 \*secid) * Retrieve the LSM-specific secid for the sock to enable caching * of network authorizations. - * @sock_graft: + * + * void sock_graft(struct sock \*sk, struct socket \*parent) * Sets the socket's isec sid to the sock's sid. - * @inet_conn_request: + * + * int inet_conn_request(const struct sock \*sk, struct sk_buff \*skb, struct request_sock \*req) * Sets the openreq's sid to socket's sid with MLS portion taken * from peer sid. - * @inet_csk_clone: + * + * void inet_csk_clone(struct sock \*newsk, const struct request_sock \*req) * Sets the new child socket's sid to the openreq sid. - * @inet_conn_established: + * + * void inet_conn_established(struct sock \*sk, struct sk_buff \*skb) * Sets the connection's peersid to the secmark on skb. - * @secmark_relabel_packet: + * + * int secmark_relabel_packet(u32 secid) * check if the process should be allowed to relabel packets to - * the given secid - * @secmark_refcount_inc: + * the given @secid + * + * void secmark_refcount_inc(void) * tells the LSM to increment the number of secmark labeling rules loaded - * @secmark_refcount_dec: + * + * void secmark_refcount_dec(void) * tells the LSM to decrement the number of secmark labeling rules loaded - * @req_classify_flow: + * + * void req_classify_flow(const struct request_sock \*req, struct flowi_common \*flic) * Sets the flow's sid to the openreq sid. - * @tun_dev_alloc_security: + * + * **Security hooks for TUN device:** + * + * int tun_dev_alloc_security(void \*\*security) * This hook allows a module to allocate a security structure for a TUN * device. - * @security pointer to a security structure pointer. - * Returns a zero on success, negative values on failure. - * @tun_dev_free_security: + * + * * @security pointer to a security structure pointer. + * * Returns a zero on success, negative values on failure. + * + * void tun_dev_free_security(void \*security) * This hook allows a module to free the security structure for a TUN * device. - * @security pointer to the TUN device's security structure - * @tun_dev_create: + * + * * @security pointer to the TUN device's security structure + * + * int tun_dev_create(void) * Check permissions prior to creating a new TUN device. - * @tun_dev_attach_queue: + * + * int tun_dev_attach_queue(void \*security) * Check permissions prior to attaching to a TUN device queue. - * @security pointer to the TUN device's security structure. - * @tun_dev_attach: + * + * * @security pointer to the TUN device's security structure. + * + * int tun_dev_attach(struct sock \*sk, void \*security) * This hook can be used by the module to update any security state * associated with the TUN device's sock structure. - * @sk contains the existing sock structure. - * @security pointer to the TUN device's security structure. - * @tun_dev_open: + * + * * @sk contains the existing sock structure. + * * @security pointer to the TUN device's security structure. + * + * int tun_dev_open(void \*security) * This hook can be used by the module to update any security state * associated with the TUN device's security structure. - * @security pointer to the TUN devices's security structure. * - * Security hooks for SCTP + * * @security pointer to the TUN devices's security structure. * - * @sctp_assoc_request: - * Passes the @ep and @chunk->skb of the association INIT packet to + * **Security hooks for SCTP:** + * + * int sctp_assoc_request(struct sctp_endpoint \*ep, struct sk_buff \*skb) + * Passes the @ep and @chunk->skb of the association %INIT packet to * the security module. - * @ep pointer to sctp endpoint structure. - * @skb pointer to skbuff of association packet. - * Return 0 on success, error on failure. - * @sctp_bind_connect: + * + * * @ep pointer to sctp endpoint structure. + * * @skb pointer to @skbuff of association packet. + * * Return %0 on success, error on failure. + * + * int sctp_bind_connect(struct sock \*sk, int optname, struct sockaddr \*address, int addrlen) * Validiate permissions required for each address associated with sock * @sk. Depending on @optname, the addresses will be treated as either * for a connect or bind service. The @addrlen is calculated on each * ipv4 and ipv6 address using sizeof(struct sockaddr_in) or * sizeof(struct sockaddr_in6). - * @sk pointer to sock structure. - * @optname name of the option to validate. - * @address list containing one or more ipv4/ipv6 addresses. - * @addrlen total length of address(s). - * Return 0 on success, error on failure. - * @sctp_sk_clone: + * + * * @sk pointer to sock structure. + * * @optname name of the option to validate. + * * @address list containing one or more ipv4/ipv6 addresses. + * * @addrlen total length of address(s). + * * Return %0 on success, error on failure. + * + * void sctp_sk_clone(struct sctp_endpoint \*ep, struct sock \*sk, struct sock \*newsk) * Called whenever a new socket is created by accept(2) (i.e. a TCP * style socket) or when a socket is 'peeled off' e.g userspace * calls sctp_peeloff(3). - * @ep pointer to current sctp endpoint structure. - * @sk pointer to current sock structure. - * @sk pointer to new sock structure. * - * Security hooks for Infiniband + * * @ep pointer to current sctp endpoint structure. + * * @sk pointer to current sock structure. + * * @sk pointer to new sock structure. * - * @ib_pkey_access: + * **Security hooks for Infiniband:** + * + * int ib_pkey_access(void \*sec, u64 subnet_prefix, u16 pkey) * Check permission to access a pkey when modifing a QP. - * @subnet_prefix the subnet prefix of the port being used. - * @pkey the pkey to be accessed. - * @sec pointer to a security structure. - * @ib_endport_manage_subnet: + * + * * @subnet_prefix the subnet prefix of the port being used. + * * @pkey the pkey to be accessed. + * * @sec pointer to a security structure. + * + * int ib_endport_manage_subnet(void \*sec, const char \*dev_name, u8 port_num) * Check permissions to send and receive SMPs on a end port. - * @dev_name the IB device name (i.e. mlx4_0). - * @port_num the port number. - * @sec pointer to a security structure. - * @ib_alloc_security: + * + * * @sec pointer to a security structure. + * * @dev_name the IB device name (i.e. mlx4_0). + * * @port_num the port number. + * + * int ib_alloc_security(void \*\*sec) * Allocate a security structure for Infiniband objects. - * @sec pointer to a security structure pointer. - * Returns 0 on success, non-zero on failure - * @ib_free_security: + * + * * @sec pointer to a security structure pointer. + * * Returns %0 on success, non-zero on failure + * + * void ib_free_security(void \*sec) * Deallocate an Infiniband security structure. - * @sec contains the security structure to be freed. * - * Security hooks for XFRM operations. + * * @sec contains the security structure to be freed. + * + * **Security hooks for XFRM operations:** * - * @xfrm_policy_alloc_security: - * @ctxp is a pointer to the xfrm_sec_ctx being added to Security Policy - * Database used by the XFRM system. - * @sec_ctx contains the security context information being provided by - * the user-level policy update program (e.g., setkey). + * int xfrm_policy_alloc_security(struct xfrm_sec_ctx \*\*ctxp, struct xfrm_user_sec_ctx \*sec_ctx, gfp_t gfp) * Allocate a security structure to the xp->security field; the security - * field is initialized to NULL when the xfrm_policy is allocated. - * Return 0 if operation was successful (memory to allocate, legal context) - * @gfp is to specify the context for the allocation - * @xfrm_policy_clone_security: - * @old_ctx contains an existing xfrm_sec_ctx. - * @new_ctxp contains a new xfrm_sec_ctx being cloned from old. + * field is initialized to %NULL when the @xfrm_policy is allocated. + * + * * @ctxp is a pointer to the xfrm_sec_ctx being added to Security Policy Database used by the XFRM system. + * * @sec_ctx contains the security context information being provided by the user-level policy update program (e.g., setkey). + * * @gfp is to specify the context for the allocation + * * Return %0 if operation was successful (memory to allocate, legal context) + * + * int xfrm_policy_clone_security(struct xfrm_sec_ctx \*old_ctx, struct xfrm_sec_ctx \*\*new_ctx) * Allocate a security structure in new_ctxp that contains the - * information from the old_ctx structure. - * Return 0 if operation was successful (memory to allocate). - * @xfrm_policy_free_security: - * @ctx contains the xfrm_sec_ctx - * Deallocate xp->security. - * @xfrm_policy_delete_security: - * @ctx contains the xfrm_sec_ctx. - * Authorize deletion of xp->security. - * @xfrm_state_alloc: - * @x contains the xfrm_state being added to the Security Association - * Database by the XFRM system. - * @sec_ctx contains the security context information being provided by - * the user-level SA generation program (e.g., setkey or racoon). - * Allocate a security structure to the x->security field; the security - * field is initialized to NULL when the xfrm_state is allocated. Set the - * context to correspond to sec_ctx. Return 0 if operation was successful - * (memory to allocate, legal context). - * @xfrm_state_alloc_acquire: - * @x contains the xfrm_state being added to the Security Association - * Database by the XFRM system. - * @polsec contains the policy's security context. - * @secid contains the secid from which to take the mls portion of the - * context. - * Allocate a security structure to the x->security field; the security - * field is initialized to NULL when the xfrm_state is allocated. Set the - * context to correspond to secid. Return 0 if operation was successful - * (memory to allocate, legal context). - * @xfrm_state_free_security: - * @x contains the xfrm_state. + * information from the @old_ctx structure. + * + * * @old_ctx contains an existing @xfrm_sec_ctx. + * * @new_ctxp contains a new @xfrm_sec_ctx being cloned from old. + * * Return %0 if operation was successful (memory to allocate). + * + * void xfrm_policy_free_security(struct xfrm_sec_ctx \*ctx) + * Deallocate @xp->security. + * + * @ctx contains the @xfrm_sec_ctx + * + * int xfrm_policy_delete_security(struct xfrm_sec_ctx \*ctx) + * Authorize deletion of @xp->security. + * + * * @ctx contains the @xfrm_sec_ctx. + * + * int xfrm_state_alloc(struct xfrm_state \*x, struct xfrm_user_sec_ctx \*sec_ctx) + * Allocate a security structure to the @x->security field; the security + * field is initialized to %NULL when the @xfrm_state is allocated. Set the + * context to correspond to @sec_ctx. + * + * * @x contains the xfrm_state being added to the Security Association Database by the XFRM system. + * * @sec_ctx contains the security context information being provided by the user-level SA generation program (e.g., setkey or racoon). + * * Return %0 if operation was successful (memory to allocate, legal context). + * + * int xfrm_state_alloc_acquire(struct xfrm_state \*x, struct xfrm_sec_ctx \*polsec, u32 secid) + * Allocate a security structure to the @x->security field; the security + * field is initialized to %NULL when the @xfrm_state is allocated. Set the + * context to correspond to @secid. + * + * * @x contains the xfrm_state being added to the Security Association Database by the XFRM system. + * * @polsec contains the policy's security context. + * * @secid contains the @secid from which to take the mls portion of the context. + * * Return %0 if operation was successful (memory to allocate, legal context). + * + * void xfrm_state_free_security(struct xfrm_state \*x) * Deallocate x->security. - * @xfrm_state_delete_security: - * @x contains the xfrm_state. - * Authorize deletion of x->security. - * @xfrm_policy_lookup: - * @ctx contains the xfrm_sec_ctx for which the access control is being - * checked. - * @fl_secid contains the flow security label that is used to authorize - * access to the policy xp. - * @dir contains the direction of the flow (input or output). - * Check permission when a flow selects a xfrm_policy for processing + * + * * @x contains the @xfrm_state. + * + * int xfrm_state_delete_security(struct xfrm_state \*x) + * Authorize deletion of @x->security. + * + * * @x contains the @xfrm_state. + * + * int xfrm_policy_lookup(struct xfrm_sec_ctx \*ctx, u32 fl_secid, u8 dir) + * Check permission when a flow selects a @xfrm_policy for processing * XFRMs on a packet. The hook is called when selecting either a * per-socket policy or a generic xfrm policy. - * Return 0 if permission is granted, -ESRCH otherwise, or -errno - * on other errors. - * @xfrm_state_pol_flow_match: - * @x contains the state to match. - * @xp contains the policy to check for a match. - * @flic contains the flowi_common struct to check for a match. - * Return 1 if there is a match. - * @xfrm_decode_session: - * @skb points to skb to decode. - * @secid points to the flow key secid to set. - * @ckall says if all xfrms used should be checked for same secid. - * Return 0 if ckall is zero or all xfrms used have the same secid. - * - * Security hooks affecting all Key Management operations - * - * @key_alloc: + * + * * @ctx contains the @xfrm_sec_ctx for which the access control is being checked. + * * @fl_secid contains the flow security label that is used to authorize access to the policy xp. + * * @dir contains the direction of the flow (input or output). + * * Return %0 if permission is granted, %-ESRCH otherwise, or %-errno on other errors. + * + * int xfrm_state_pol_flow_match(struct xfrm_state \*x, struct xfrm_policy \*xp, const struct flowi_common \*flic) + * TODO Add function definition to correctly format kernel doc. + * + * * @x contains the state to match. + * * @xp contains the policy to check for a match. + * * @flic contains the @flowi_common struct to check for a match. + * * Return %1 if there is a match. + * + * int xfrm_decode_session(struct sk_buff \*skb, u32 \*secid, int ckall) + * TODO Add function definition to correctly format kernel doc. + * + * * @skb points to skb to decode. + * * @secid points to the flow key @secid to set. + * * @ckall says if all xfrms used should be checked for same @secid. + * * Return %0 if @ckall is zero or all xfrms used have the same @secid. + * + * **Security hooks affecting all Key Management operations:** + * + * int key_alloc(struct key \*key, const struct cred \*cred, unsigned long flags) * Permit allocation of a key and assign security data. Note that key does * not have a serial number assigned at this point. - * @key points to the key. - * @flags is the allocation flags - * Return 0 if permission is granted, -ve error otherwise. - * @key_free: + * + * * @key points to the key. + * * @flags is the allocation flags + * * Return %0 if permission is granted, %-ve error otherwise. + * + * void key_free(struct key \*key) * Notification of destruction; free security data. - * @key points to the key. - * No return value. - * @key_permission: + * + * * @key points to the key. + * * No return value. + * + * int key_permission(key_ref_t key_ref, const struct cred \*cred, enum key_need_perm need_perm) * See whether a specific operational right is granted to a process on a * key. - * @key_ref refers to the key (key pointer + possession attribute bit). - * @cred points to the credentials to provide the context against which to - * evaluate the security data on the key. - * @perm describes the combination of permissions required of this key. - * Return 0 if permission is granted, -ve error otherwise. - * @key_getsecurity: + * + * * @key_ref refers to the key (key pointer + possession attribute bit). + * * @cred points to the credentials to provide the context against which to evaluate the security data on the key. + * * @perm describes the combination of permissions required of this key. + * * Return %0 if permission is granted, %-ve error otherwise. + * + * int key_getsecurity(struct key \*key, char \*\*_buffer) * Get a textual representation of the security context attached to a key - * for the purposes of honouring KEYCTL_GETSECURITY. This function - * allocates the storage for the NUL-terminated string and the caller + * for the purposes of honouring %KEYCTL_GETSECURITY. This function + * allocates the storage for the %NUL terminated string and the caller * should free it. - * @key points to the key to be queried. - * @_buffer points to a pointer that should be set to point to the - * resulting string (if no label or an error occurs). - * Return the length of the string (including terminating NUL) or -ve if - * an error. - * May also return 0 (and a NULL buffer pointer) if there is no label. * - * Security hooks affecting all System V IPC operations. + * * @key points to the key to be queried. + * * @_buffer points to a pointer that should be set to point to the resulting string (if no label or an error occurs). + * * Return the length of the string (including terminating %NUL) or %-ve if an error. + * * May also Return %0 (and a %NULL buffer pointer) if there is no label. + * + * **Security hooks affecting all System V IPC operations:** * - * @ipc_permission: + * int ipc_permission(struct kern_ipc_perm \*ipcp, short flag) * Check permissions for access to IPC - * @ipcp contains the kernel IPC permission structure - * @flag contains the desired (requested) permission set - * Return 0 if permission is granted. - * @ipc_getsecid: + * + * * @ipcp contains the kernel IPC permission structure + * * @flag contains the desired (requested) permission set + * * Return %0 if permission is granted. + * + * void ipc_getsecid(struct kern_ipc_perm \*ipcp, u32 \*secid) * Get the secid associated with the ipc object. - * @ipcp contains the kernel IPC permission structure. - * @secid contains a pointer to the location where result will be saved. - * In case of failure, @secid will be set to zero. * - * Security hooks for individual messages held in System V IPC message queues + * * @ipcp contains the kernel IPC permission structure. + * * @secid contains a pointer to the location where result will be saved. + * * In case of failure, @secid will be set to zero. + * + * **Security hooks for individual messages held in System V IPC message queues:** * - * @msg_msg_alloc_security: - * Allocate and attach a security structure to the msg->security field. - * The security field is initialized to NULL when the structure is first + * int msg_msg_alloc_security(struct msg_msg \*msg) + * Allocate and attach a security structure to the @msg->security field. + * The security field is initialized to %NULL when the structure is first * created. - * @msg contains the message structure to be modified. - * Return 0 if operation was successful and permission is granted. - * @msg_msg_free_security: + * + * * @msg contains the message structure to be modified. + * * Return %0 if operation was successful and permission is granted. + * + * void msg_msg_free_security(struct msg_msg \*msg) * Deallocate the security structure for this message. - * @msg contains the message structure to be modified. * - * Security hooks for System V IPC Message Queues + * * @msg contains the message structure to be modified. + * + * **Security hooks for System V IPC Message Queues:** * - * @msg_queue_alloc_security: + * int msg_queue_alloc_security(struct kern_ipc_perm \*perm) * Allocate and attach a security structure to the * @perm->security field. The security field is initialized to - * NULL when the structure is first created. - * @perm contains the IPC permissions of the message queue. - * Return 0 if operation was successful and permission is granted. - * @msg_queue_free_security: + * %NULL when the structure is first created. + * + * * @perm contains the IPC permissions of the message queue. + * * Return %0 if operation was successful and permission is granted. + * + * void msg_queue_free_security(struct kern_ipc_perm \*perm) * Deallocate security field @perm->security for the message queue. - * @perm contains the IPC permissions of the message queue. - * @msg_queue_associate: + * + * * @perm contains the IPC permissions of the message queue. + * + * int msg_queue_associate(struct kern_ipc_perm \*perm, int msqflg) * Check permission when a message queue is requested through the * msgget system call. This hook is only called when returning the * message queue identifier for an existing message queue, not when a * new message queue is created. - * @perm contains the IPC permissions of the message queue. - * @msqflg contains the operation control flags. - * Return 0 if permission is granted. - * @msg_queue_msgctl: + * + * * @perm contains the IPC permissions of the message queue. + * * @msqflg contains the operation control flags. + * * Return %0 if permission is granted. + * + * int msg_queue_msgctl(struct kern_ipc_perm \*perm, int cmd) * Check permission when a message control operation specified by @cmd * is to be performed on the message queue with permissions @perm. - * The @perm may be NULL, e.g. for IPC_INFO or MSG_INFO. - * @perm contains the IPC permissions of the msg queue. May be NULL. - * @cmd contains the operation to be performed. - * Return 0 if permission is granted. - * @msg_queue_msgsnd: + * The @perm may be %NULL, e.g. for %IPC_INFO or %MSG_INFO. + * + * * @perm contains the IPC permissions of the msg queue. May be %NULL. + * * @cmd contains the operation to be performed. + * * Return %0 if permission is granted. + * + * int msg_queue_msgsnd(struct kern_ipc_perm \*perm, struct msg_msg \*msg, int msqflg) * Check permission before a message, @msg, is enqueued on the message * queue with permissions @perm. - * @perm contains the IPC permissions of the message queue. - * @msg contains the message to be enqueued. - * @msqflg contains operational flags. - * Return 0 if permission is granted. - * @msg_queue_msgrcv: + * + * * @perm contains the IPC permissions of the message queue. + * * @msg contains the message to be enqueued. + * * @msqflg contains operational flags. + * * Return %0 if permission is granted. + * + * int msg_queue_msgrcv(struct kern_ipc_perm \*perm, struct msg_msg \*msg, struct task_struct \*target, long type, int mode) * Check permission before a message, @msg, is removed from the message * queue. The @target task structure contains a pointer to the * process that will be receiving the message (not equal to the current * process when inline receives are being performed). - * @perm contains the IPC permissions of the message queue. - * @msg contains the message destination. - * @target contains the task structure for recipient process. - * @type contains the type of message requested. - * @mode contains the operational flags. - * Return 0 if permission is granted. * - * Security hooks for System V Shared Memory Segments + * * @perm contains the IPC permissions of the message queue. + * * @msg contains the message destination. + * * @target contains the task structure for recipient process. + * * @type contains the type of message requested. + * * @mode contains the operational flags. + * * Return %0 if permission is granted. + * + * **Security hooks for System V Shared Memory Segments:** * - * @shm_alloc_security: + * int shm_alloc_security(struct kern_ipc_perm \*perm) * Allocate and attach a security structure to the @perm->security - * field. The security field is initialized to NULL when the structure is + * field. The security field is initialized to %NULL when the structure is * first created. - * @perm contains the IPC permissions of the shared memory structure. - * Return 0 if operation was successful and permission is granted. - * @shm_free_security: + * + * * @perm contains the IPC permissions of the shared memory structure. + * * Return %0 if operation was successful and permission is granted. + * + * void shm_free_security(struct kern_ipc_perm \*perm) * Deallocate the security structure @perm->security for the memory segment. - * @perm contains the IPC permissions of the shared memory structure. - * @shm_associate: + * + * * @perm contains the IPC permissions of the shared memory structure. + * + * int shm_associate(struct kern_ipc_perm \*perm, int shmflg) * Check permission when a shared memory region is requested through the - * shmget system call. This hook is only called when returning the shared + * @shmget() system call. This hook is only called when returning the shared * memory region identifier for an existing region, not when a new shared * memory region is created. - * @perm contains the IPC permissions of the shared memory structure. - * @shmflg contains the operation control flags. - * Return 0 if permission is granted. - * @shm_shmctl: + * + * * @perm contains the IPC permissions of the shared memory structure. + * * @shmflg contains the operation control flags. + * * Return %0 if permission is granted. + * + * int shm_shmctl(struct kern_ipc_perm \*perm, int cmd) * Check permission when a shared memory control operation specified by * @cmd is to be performed on the shared memory region with permissions @perm. - * The @perm may be NULL, e.g. for IPC_INFO or SHM_INFO. - * @perm contains the IPC permissions of the shared memory structure. - * @cmd contains the operation to be performed. - * Return 0 if permission is granted. - * @shm_shmat: + * The @perm may be %NULL, e.g. for %IPC_INFO or %SHM_INFO. + * + * * @perm contains the IPC permissions of the shared memory structure. + * * @cmd contains the operation to be performed. + * * Return %0 if permission is granted. + * + * int shm_shmat(struct kern_ipc_perm \*perm, char __user \*shmaddr, int shmflg) * Check permissions prior to allowing the shmat system call to attach the * shared memory segment with permissions @perm to the data segment of the * calling process. The attaching address is specified by @shmaddr. - * @perm contains the IPC permissions of the shared memory structure. - * @shmaddr contains the address to attach memory region to. - * @shmflg contains the operational flags. - * Return 0 if permission is granted. * - * Security hooks for System V Semaphores + * * @perm contains the IPC permissions of the shared memory structure. + * * @shmaddr contains the address to attach memory region to. + * * @shmflg contains the operational flags. + * * Return %0 if permission is granted. + * + * **Security hooks for System V Semaphores:** * - * @sem_alloc_security: + * int sem_alloc_security(struct kern_ipc_perm \*perm) * Allocate and attach a security structure to the @perm->security - * field. The security field is initialized to NULL when the structure is + * field. The security field is initialized to %NULL when the structure is * first created. - * @perm contains the IPC permissions of the semaphore. - * Return 0 if operation was successful and permission is granted. - * @sem_free_security: + * + * * @perm contains the IPC permissions of the semaphore. + * * Return %0 if operation was successful and permission is granted. + * + * void sem_free_security(struct kern_ipc_perm \*perm) * Deallocate security structure @perm->security for the semaphore. - * @perm contains the IPC permissions of the semaphore. - * @sem_associate: - * Check permission when a semaphore is requested through the semget + * + * * @perm contains the IPC permissions of the semaphore. + * + * int sem_associate(struct kern_ipc_perm \*perm, int semflg) + * Check permission when a semaphore is requested through the @semget() * system call. This hook is only called when returning the semaphore * identifier for an existing semaphore, not when a new one must be * created. - * @perm contains the IPC permissions of the semaphore. - * @semflg contains the operation control flags. - * Return 0 if permission is granted. - * @sem_semctl: + * + * * @perm contains the IPC permissions of the semaphore. + * * @semflg contains the operation control flags. + * * Return %0 if permission is granted. + * + * int sem_semctl(struct kern_ipc_perm \*perm, int cmd) * Check permission when a semaphore operation specified by @cmd is to be - * performed on the semaphore. The @perm may be NULL, e.g. for - * IPC_INFO or SEM_INFO. - * @perm contains the IPC permissions of the semaphore. May be NULL. - * @cmd contains the operation to be performed. - * Return 0 if permission is granted. - * @sem_semop: + * performed on the semaphore. The @perm may be %NULL, e.g. for + * %IPC_INFO or %SEM_INFO. + * + * * @perm contains the IPC permissions of the semaphore. May be %NULL. + * * @cmd contains the operation to be performed. + * * Return %0 if permission is granted. + * + * int sem_semop(struct kern_ipc_perm \*perm, struct sembuf \*sops, unsigned nsops, int alter) * Check permissions before performing operations on members of the * semaphore set. If the @alter flag is nonzero, the semaphore set * may be modified. - * @perm contains the IPC permissions of the semaphore. - * @sops contains the operations to perform. - * @nsops contains the number of operations to perform. - * @alter contains the flag indicating whether changes are to be made. - * Return 0 if permission is granted. * - * @binder_set_context_mgr: + * * @perm contains the IPC permissions of the semaphore. + * * @sops contains the operations to perform. + * * @nsops contains the number of operations to perform. + * * @alter contains the flag indicating whether changes are to be made. + * * Return %0 if permission is granted. + * + * **Security hooks for Binder device:** + * + * int binder_set_context_mgr(struct task_struct \*mgr) * Check whether @mgr is allowed to be the binder context manager. - * @mgr contains the task_struct for the task being registered. - * Return 0 if permission is granted. - * @binder_transaction: + * + * * @mgr contains the @task_struct for the task being registered. + * * Return %0 if permission is granted. + * + * int binder_transaction(struct task_struct \*from, struct task_struct \*to) * Check whether @from is allowed to invoke a binder transaction call * to @to. - * @from contains the task_struct for the sending task. - * @to contains the task_struct for the receiving task. - * @binder_transfer_binder: + * + * * @from contains the @task_struct for the sending task. + * * @to contains the @task_struct for the receiving task. + * + * int binder_transfer_binder(struct task_struct \*from, struct task_struct \*to) * Check whether @from is allowed to transfer a binder reference to @to. - * @from contains the task_struct for the sending task. - * @to contains the task_struct for the receiving task. - * @binder_transfer_file: + * + * * @from contains the @task_struct for the sending task. + * * @to contains the @task_struct for the receiving task. + * + * int binder_transfer_file(struct task_struct \*from, struct task_struct \*to, struct file \*file) * Check whether @from is allowed to transfer @file to @to. - * @from contains the task_struct for the sending task. - * @file contains the struct file being transferred. - * @to contains the task_struct for the receiving task. * - * @ptrace_access_check: + * * @from contains the @task_struct for the sending task. + * * @file contains the struct file being transferred. + * * @to contains the @task_struct for the receiving task. + * + * **Security hooks for ptrace:** + * + * int ptrace_access_check(struct task_struct \*child, unsigned int mode) * Check permission before allowing the current process to trace the * @child process. * Security modules may also want to perform a process tracing check - * during an execve in the set_security or apply_creds hooks of - * tracing check during an execve in the bprm_set_creds hook of - * binprm_security_ops if the process is being traced and its security - * attributes would be changed by the execve. - * @child contains the task_struct structure for the target process. - * @mode contains the PTRACE_MODE flags indicating the form of access. - * Return 0 if permission is granted. - * @ptrace_traceme: + * during an @execve in the set_security or @apply_creds() hooks of + * tracing check during an @execve in the @bprm_set_creds() hook of + * @binprm_security_ops() if the process is being traced and its security + * attributes would be changed by the @execve. + * + * * @child contains the @task_struct structure for the target process. + * * @mode contains the %PTRACE_MODE flags indicating the form of access. + * * Return %0 if permission is granted. + * + * int ptrace_traceme(struct task_struct \*parent) * Check that the @parent process has sufficient permission to trace the * current process before allowing the current process to present itself * to the @parent process for tracing. - * @parent contains the task_struct structure for debugger process. - * Return 0 if permission is granted. - * @capget: + * + * * @parent contains the @task_struct structure for debugger process. + * * Return %0 if permission is granted. + * + * int capget(struct task_struct \*target, kernel_cap_t \*effective, kernel_cap_t \*inheritable, kernel_cap_t \*permitted) * Get the @effective, @inheritable, and @permitted capability sets for * the @target process. The hook may also perform permission checking to * determine if the current process is allowed to see the capability sets * of the @target process. - * @target contains the task_struct structure for target process. - * @effective contains the effective capability set. - * @inheritable contains the inheritable capability set. - * @permitted contains the permitted capability set. - * Return 0 if the capability sets were successfully obtained. - * @capset: + * + * * @target contains the @task_struct structure for target process. + * * @effective contains the effective capability set. + * * @inheritable contains the inheritable capability set. + * * @permitted contains the permitted capability set. + * * Return %0 if the capability sets were successfully obtained. + * + * int capset(struct cred \*new, const struct cred \*old, const kernel_cap_t \*effective, const kernel_cap_t \*inheritable, const kernel_cap_t \*permitted) * Set the @effective, @inheritable, and @permitted capability sets for * the current process. - * @new contains the new credentials structure for target process. - * @old contains the current credentials structure for target process. - * @effective contains the effective capability set. - * @inheritable contains the inheritable capability set. - * @permitted contains the permitted capability set. - * Return 0 and update @new if permission is granted. - * @capable: + * + * * @new contains the new credentials structure for target process. + * * @old contains the current credentials structure for target process. + * * @effective contains the effective capability set. + * * @inheritable contains the inheritable capability set. + * * @permitted contains the permitted capability set. + * * Return %0 and update @new if permission is granted. + * + * int capable(const struct cred \*cred, struct user_namespace \*ns, int cap, unsigned int opts) * Check whether the @tsk process has the @cap capability in the indicated * credentials. - * @cred contains the credentials to use. - * @ns contains the user namespace we want the capability in - * @cap contains the capability . - * @opts contains options for the capable check - * Return 0 if the capability is granted for @tsk. - * @quotactl: - * Check whether the quotactl syscall is allowed for this @sb. - * @quota_on: - * Check whether QUOTAON is allowed for this @dentry. - * @syslog: + * + * * @cred contains the credentials to use. + * * @ns contains the user namespace we want the capability in + * * @cap contains the capability . + * * @opts contains options for the capable check + * * Return %0 if the capability is granted for @tsk. + * + * int quotactl(int cmds, int type, int id, struct super_block \*sb) + * Check whether the @quotactl syscall is allowed for this @sb. + * + * int quota_on(struct dentry \*dentry) + * Check whether %QUOTAON is allowed for this @dentry. + * + * int syslog(int type) * Check permission before accessing the kernel message ring or changing * logging to the console. * See the syslog(2) manual page for an explanation of the @type values. - * @type contains the SYSLOG_ACTION_* constant from - * Return 0 if permission is granted. - * @settime: + * + * * @type contains the %SYSLOG_ACTION_\* constant from + * * Return %0 if permission is granted. + * + * int settime(const struct timespec64 \*ts, const struct timezone \*tz) * Check permission to change the system time. * struct timespec64 is defined in and timezone * is defined in - * @ts contains new time - * @tz contains new timezone - * Return 0 if permission is granted. - * @vm_enough_memory: + * + * * @ts contains new time + * * @tz contains new timezone + * * Return %0 if permission is granted. + * + * int vm_enough_memory(struct mm_struct \*mm, long pages) * Check permissions for allocating a new virtual mapping. - * @mm contains the mm struct it is being added to. - * @pages contains the number of pages. - * Return 0 if permission is granted. * - * @ismaclabel: + * * @mm contains the mm struct it is being added to. + * * @pages contains the number of pages. + * * Return %0 if permission is granted. + * + * int ismaclabel(const char \*name) * Check if the extended attribute specified by @name - * represents a MAC label. Returns 1 if name is a MAC - * attribute otherwise returns 0. - * @name full extended attribute name to check against - * LSM as a MAC label. - * - * @secid_to_secctx: - * Convert secid to security context. If secdata is NULL the length of - * the result will be returned in seclen, but no secdata will be returned. + * represents a MAC label. Returns %1 if name is a MAC + * attribute otherwise returns %0. + * + * * @name full extended attribute name to check against LSM as a MAC label. + * + * **Security hooks for managing security blobs:** + * + * int secid_to_secctx(u32 secid, char \*\*secdata, u32 \*seclen) + * Convert @secid to security context. If @secdata is %NULL the length of + * the result will be returned in @seclen, but no @secdata will be returned. * This does mean that the length could change between calls to check the * length and the next call which actually allocates and returns the - * secdata. - * @secid contains the security ID. - * @secdata contains the pointer that stores the converted security - * context. - * @seclen pointer which contains the length of the data - * @secctx_to_secid: - * Convert security context to secid. - * @secid contains the pointer to the generated security ID. - * @secdata contains the security context. - * - * @release_secctx: + * @secdata. + * + * * @secid contains the security ID. + * * @secdata contains the pointer that stores the converted security context. + * * @seclen pointer which contains the length of the data + * + * int secctx_to_secid(const char \*secdata, u32 seclen, u32 \*secid) + * Convert security context to @secid. + * + * * @secid contains the pointer to the generated security ID. + * * @secdata contains the security context. + * + * void release_secctx(char \*secdata, u32 seclen) * Release the security context. - * @secdata contains the security context. - * @seclen contains the length of the security context. * - * Security hooks for Audit + * * @secdata contains the security context. + * * @seclen contains the length of the security context. * - * @audit_rule_init: + * **Security hooks for Audit:** + * + * int audit_rule_init(u32 field, u32 op, char \*rulestr, void \*\*lsmrule) * Allocate and initialize an LSM audit rule structure. - * @field contains the required Audit action. - * Fields flags are defined in - * @op contains the operator the rule uses. - * @rulestr contains the context where the rule will be applied to. - * @lsmrule contains a pointer to receive the result. - * Return 0 if @lsmrule has been successfully set, - * -EINVAL in case of an invalid rule. - * - * @audit_rule_known: + * + * * @field contains the required Audit action. Fields flags are defined in + * * @op contains the operator the rule uses. + * * @rulestr contains the context where the rule will be applied to. + * * @lsmrule contains a pointer to receive the result. + * * Return %0 if @lsmrule has been successfully set, + * * %-EINVAL in case of an invalid rule. + * + * int audit_rule_known(struct audit_krule \*krule) * Specifies whether given @krule contains any fields related to * current LSM. - * @krule contains the audit rule of interest. - * Return 1 in case of relation found, 0 otherwise. * - * @audit_rule_match: + * * @krule contains the audit rule of interest. + * * Return %1 in case of relation found, 0 otherwise. + * + * int audit_rule_match(u32 secid, u32 field, u32 op, void \*lsmrule) * Determine if given @secid matches a rule previously approved * by @audit_rule_known. - * @secid contains the security id in question. - * @field contains the field which relates to current LSM. - * @op contains the operator that will be used for matching. - * @lrule points to the audit rule that will be checked against. - * Return 1 if secid matches the rule, 0 if it does not, -ERRNO on failure. * - * @audit_rule_free: + * * @secid contains the security id in question. + * * @field contains the field which relates to current LSM. + * * @op contains the operator that will be used for matching. + * * @lsmrule points to the audit rule that will be checked against. + * * Return %1 if @secid matches the rule, %0 if it does not, %-ERRNO on failure. + * + * void audit_rule_free(void \*lsmrule) * Deallocate the LSM audit rule structure previously allocated by - * audit_rule_init. - * @lsmrule contains the allocated rule + * @audit_rule_init(). + * + * * @lsmrule contains the allocated rule + * + * **Security hooks for more inode services:** * - * @inode_invalidate_secctx: + * void inode_invalidate_secctx(struct inode \*inode) * Notify the security module that it must revalidate the security context * of an inode. * - * @inode_notifysecctx: + * int inode_notifysecctx(struct inode \*inode, void \*ctx, u32 ctxlen) * Notify the security module of what the security context of an inode * should be. Initializes the incore security context managed by the * security module for this inode. Example usage: NFS client invokes * this hook to initialize the security context in its incore inode to the * value provided by the server for the file when the server returned the * file's attributes to the client. - * Must be called with inode->i_mutex locked. - * @inode we wish to set the security context of. - * @ctx contains the string which we wish to set in the inode. - * @ctxlen contains the length of @ctx. + * Must be called with @inode->i_mutex locked. * - * @inode_setsecctx: + * * @inode we wish to set the security context of. + * * @ctx contains the string which we wish to set in the inode. + * * @ctxlen contains the length of @ctx. + * + * int inode_setsecctx(struct dentry \*dentry, void \*ctx, u32 ctxlen) * Change the security context of an inode. Updates the * incore security context managed by the security module and invokes the - * fs code as needed (via __vfs_setxattr_noperm) to update any backing - * xattrs that represent the context. Example usage: NFS server invokes + * fs code as needed (via @__vfs_setxattr_noperm()) to update any backing + * @xattrs that represent the context. Example usage: NFS server invokes * this hook to change the security context in its incore inode and on the - * backing filesystem to a value provided by the client on a SETATTR + * backing filesystem to a value provided by the client on a %SETATTR * operation. - * Must be called with inode->i_mutex locked. - * @dentry contains the inode we wish to set the security context of. - * @ctx contains the string which we wish to set in the inode. - * @ctxlen contains the length of @ctx. + * Must be called with @inode->i_mutex locked. + * + * * @dentry contains the inode we wish to set the security context of. + * * @ctx contains the string which we wish to set in the inode. + * * @ctxlen contains the length of @ctx. * - * @inode_getsecctx: - * On success, returns 0 and fills out @ctx and @ctxlen with the security + * int inode_getsecctx(struct inode \*inode, void \*\*ctx, u32 \*ctxlen) + * On success, returns %0 and fills out @ctx and @ctxlen with the security * context for the given @inode. - * @inode we wish to get the security context of. - * @ctx is a pointer in which to place the allocated security context. - * @ctxlen points to the place to put the length of @ctx. * - * Security hooks for the general notification queue: + * * @inode we wish to get the security context of. + * * @ctx is a pointer in which to place the allocated security context. + * * @ctxlen points to the place to put the length of @ctx. + * + * **Security hooks for the general notification queue:** * - * @post_notification: + * int post_notification(const struct cred \*w_cred, const struct cred \*cred, struct watch_notification \*n) * Check to see if a watch notification can be posted to a particular * queue. - * @w_cred: The credentials of the whoever set the watch. - * @cred: The event-triggerer's credentials - * @n: The notification being posted * - * @watch_key: + * * @w_cred The credentials of the whoever set the watch. + * * @cred The event-triggerer's credentials + * * @n The notification being posted + * + * int watch_key(struct key \*key) * Check to see if a process is allowed to watch for event notifications * from a key or keyring. - * @key: The key to watch. * - * Security hooks for using the eBPF maps and programs functionalities through - * eBPF syscalls. + * * @key The key to watch. + * + * **Security hooks for using the eBPF maps and programs functionalities** + * **through eBPF syscalls:** * - * @bpf: - * Do a initial check for all bpf syscalls after the attribute is copied + * int bpf(int cmd, union bpf_attr \*attr, unsigned int size) + * Do a initial check for all @bpf syscalls after the attribute is copied * into the kernel. The actual security module can implement their own * rules to check the specific cmd they need. * - * @bpf_map: + * int bpf_map(struct bpf_map \*map, fmode_t fmode) * Do a check when the kernel generate and return a file descriptor for * eBPF maps. * - * @map: bpf map that we want to access - * @mask: the access flags + * * @map bpf map that we want to access + * * @mask the access flags * - * @bpf_prog: + * int bpf_prog(struct bpf_prog \*prog) * Do a check when the kernel generate and return a file descriptor for * eBPF programs. * - * @prog: bpf prog that userspace want to use. + * * @prog bpf prog that userspace want to use. * - * @bpf_map_alloc_security: + * int bpf_map_alloc_security(struct bpf_map \*map) * Initialize the security field inside bpf map. * - * @bpf_map_free_security: + * void bpf_map_free_security((struct bpf_map \*map) * Clean up the security information stored inside bpf map. * - * @bpf_prog_alloc_security: + * int bpf_prog_alloc_security(struct bpf_prog_aux \*aux) * Initialize the security field inside bpf program. * - * @bpf_prog_free_security: + * void bpf_prog_free_security(struct bpf_prog_aux \*aux) * Clean up the security information stored inside bpf prog. * - * @locked_down: + * **Security hooks for lockdown:** + * + * int locked_down(enum lockdown_reason what) * Determine whether a kernel feature that potentially enables arbitrary * code execution in kernel space should be permitted. * - * @what: kernel feature being accessed + * * @what kernel feature being accessed + * + * **Security hooks for perf events:** + * + * int perf_event_open(struct perf_event_attr \*attr, int type) + * Check whether the @type of @perf_event_open() @syscall() is allowed. + * + * int perf_event_alloc(struct perf_event \*event) + * Allocate and save @perf_event security info. + * + * void perf_event_free(struct perf_event \*event) + * Release (free) @perf_event security info. * - * Security hooks for perf events + * int perf_event_read(struct perf_event \*event) + * Read @perf_event security info if allowed. * - * @perf_event_open: - * Check whether the @type of perf_event_open syscall is allowed. - * @perf_event_alloc: - * Allocate and save perf_event security info. - * @perf_event_free: - * Release (free) perf_event security info. - * @perf_event_read: - * Read perf_event security info if allowed. - * @perf_event_write: - * Write perf_event security info if allowed. + * int perf_event_write(struct perf_event \event) + * Write @perf_event security info if allowed. */ union security_list_options { #define LSM_HOOK(RET, DEFAULT, NAME, ...) RET (*NAME)(__VA_ARGS__);