From patchwork Tue Sep 17 14:56:39 2019 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Richard Haines X-Patchwork-Id: 11148947 Return-Path: Received: from mail.kernel.org (pdx-korg-mail-1.web.codeaurora.org [172.30.200.123]) by pdx-korg-patchwork-2.web.codeaurora.org (Postfix) with ESMTP id 3F26014F7 for ; Tue, 17 Sep 2019 14:56:50 +0000 (UTC) Received: from vger.kernel.org (vger.kernel.org [209.132.180.67]) by mail.kernel.org (Postfix) with ESMTP id 0897C21852 for ; Tue, 17 Sep 2019 14:56:50 +0000 (UTC) Authentication-Results: mail.kernel.org; dkim=pass (2048-bit key) header.d=btinternet.com header.i=@btinternet.com header.b="JMlY2P/x" Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1727708AbfIQO4t (ORCPT ); Tue, 17 Sep 2019 10:56:49 -0400 Received: from mailomta27-re.btinternet.com ([213.120.69.120]:32272 "EHLO re-prd-fep-040.btinternet.com" rhost-flags-OK-OK-OK-FAIL) by vger.kernel.org with ESMTP id S1728187AbfIQO4t (ORCPT ); Tue, 17 Sep 2019 10:56:49 -0400 Received: from re-prd-rgout-003.btmx-prd.synchronoss.net ([10.2.54.6]) by re-prd-fep-040.btinternet.com with ESMTP id <20190917145646.DSE17605.re-prd-fep-040.btinternet.com@re-prd-rgout-003.btmx-prd.synchronoss.net>; Tue, 17 Sep 2019 15:56:46 +0100 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=btinternet.com; s=btmx201904; t=1568732206; bh=dcV9ClDPs0Id7kcPTy9ltrPsP9UUCyuwD9uzEhAQa3M=; h=From:To:Cc:Subject:Date:Message-Id:X-Mailer:In-Reply-To:References:MIME-Version; b=JMlY2P/xtRCiqUJZXExZ1UmoUGBLkkMEuTomjNZviIlLj3NGuIY3E88rGst81x0c4X+VPRQR5KX3b/JDl9D5sml0V4MgkuK/TRwRo20rHDSv48OWiCry3Jp7owcv7mKloXOmSE380k6y+ppHda5cvKeAhXQYyXbBEIlnndifA1lahsHVj4ND3jhDs7I1rD2e/aC/h/VunKf2s+lPaZg1F+0Q/0y/0CPHhvH/KbVORZj5NdXz4gnDMzLWVj4oc9fwm+yUdkQFWe+oXwZPsTCus5L2TM3YZa24rOHloVevvluGQPYqm/7+UqyXqnyJX8iTPUsVFTjWewcjQKxo9eCu0Q== Authentication-Results: btinternet.com; none X-Originating-IP: [86.134.6.116] X-OWM-Source-IP: 86.134.6.116 (GB) X-OWM-Env-Sender: richard_c_haines@btinternet.com X-VadeSecure-score: verdict=clean score=0/300, class=clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedufedrudeigdehhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemuceutffkvffkuffjvffgnffgvefqofdpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkofgjfhgggfestdekredtredttdenucfhrhhomheptfhitghhrghrugcujfgrihhnvghsuceorhhitghhrghruggptggphhgrihhnvghssegsthhinhhtvghrnhgvthdrtghomheqnecukfhppeekiedrudefgedriedrudduieenucfrrghrrghmpehhvghloheplhhotggrlhhhohhsthdrlhhotggrlhguohhmrghinhdpihhnvghtpeekiedrudefgedriedrudduiedpmhgrihhlfhhrohhmpeeorhhitghhrghruggptggphhgrihhnvghssegsthhinhhtvghrnhgvthdrtghomheqpdhrtghpthhtohepoehprghulhesphgruhhlqdhmohhorhgvrdgtohhmqedprhgtphhtthhopeeorhhitghhrghruggptggphhgrihhnvghssegsthhinhhtvghrnhgvthdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrhhitghhrghruggptggphhgrihhnvghssegsthhinhhtvghrnhgvthdrtghomhdprhgtphhtthhopeeoshgushesthihtghhohdrnhhsrgdrghhovheqpdhrtghpthhtohepoehsvghlihhnuhigsehvghgvrhdrkhgvrhhnvghlrdhorhhgqeenucevlhhushhtvghrufhiiigvpedt X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean Received: from localhost.localdomain (86.134.6.116) by re-prd-rgout-003.btmx-prd.synchronoss.net (5.8.337) (authenticated as richard_c_haines@btinternet.com) id 5D7F5CD800382C67; Tue, 17 Sep 2019 15:56:46 +0100 From: Richard Haines To: selinux@vger.kernel.org, paul@paul-moore.com, sds@tycho.nsa.gov Cc: Richard Haines Subject: [PATCH V4 2/3] selinux-testsuite: Add BPF support to fdreceive test Date: Tue, 17 Sep 2019 15:56:39 +0100 Message-Id: <20190917145640.25629-3-richard_c_haines@btinternet.com> X-Mailer: git-send-email 2.21.0 In-Reply-To: <20190917145640.25629-1-richard_c_haines@btinternet.com> References: <20190917145640.25629-1-richard_c_haines@btinternet.com> MIME-Version: 1.0 Sender: selinux-owner@vger.kernel.org Precedence: bulk List-ID: X-Mailing-List: selinux@vger.kernel.org Add BPF map & prog functions to test fdreceive security_file_receive path() Signed-off-by: Richard Haines --- policy/Makefile | 2 +- policy/test_fdreceive_bpf.te | 60 +++++++++++++++++++++++ tests/bpf/Makefile | 7 +++ tests/bpf/test | 55 ++++++++++++++++++++- tests/fdreceive/Makefile | 14 +++++- tests/fdreceive/client.c | 93 ++++++++++++++++++++++++++++++++---- 6 files changed, 218 insertions(+), 13 deletions(-) create mode 100644 policy/test_fdreceive_bpf.te diff --git a/policy/Makefile b/policy/Makefile index 16a4469..4ca5486 100644 --- a/policy/Makefile +++ b/policy/Makefile @@ -72,7 +72,7 @@ TARGETS += test_sctp.te endif ifeq ($(shell grep -q bpf $(POLDEV)/include/support/all_perms.spt && echo true),true) -TARGETS += test_bpf.te +TARGETS += test_bpf.te test_fdreceive_bpf.te endif ifeq (x$(DISTRO),$(filter x$(DISTRO),xRHEL4 xRHEL5 xRHEL6)) diff --git a/policy/test_fdreceive_bpf.te b/policy/test_fdreceive_bpf.te new file mode 100644 index 0000000..961de79 --- /dev/null +++ b/policy/test_fdreceive_bpf.te @@ -0,0 +1,60 @@ +################################# +# +# Policy for testing BPF file descriptor transfer via socket IPC +# + +attribute fdreceivebpfdomain; + +# Domain for bpf client process. +type test_fdreceive_bpf_client_t; +domain_type(test_fdreceive_bpf_client_t) +unconfined_runs_test(test_fdreceive_bpf_client_t) +typeattribute test_fdreceive_bpf_client_t fdreceivebpfdomain; +typeattribute test_fdreceive_bpf_client_t testdomain; +allow test_fdreceive_bpf_client_t test_fdreceive_file_t:file { rw_file_perms }; +allow test_fdreceive_bpf_client_t test_file_t:sock_file { rw_sock_file_perms }; +allow test_fdreceive_bpf_client_t test_fdreceive_server_t:unix_stream_socket { connectto }; +allow test_fdreceive_bpf_client_t self:bpf { map_create map_read map_write prog_load prog_run }; +allow test_fdreceive_bpf_client_t self:capability { sys_resource }; +allow test_fdreceive_bpf_client_t self:process { setrlimit }; +# Server side rules: +allow test_fdreceive_server_t test_fdreceive_bpf_client_t:fd { use }; +allow test_fdreceive_server_t test_fdreceive_bpf_client_t:bpf { map_read map_write }; +allow test_fdreceive_server_t test_fdreceive_bpf_client_t:bpf { prog_run} ; + +# Domain for bpf client2 process - Removes BPF prog_run perm from server. +# Tests security_file_receive flow. +type test_fdreceive_bpf_client2_t; +domain_type(test_fdreceive_bpf_client2_t) +unconfined_runs_test(test_fdreceive_bpf_client2_t) +typeattribute test_fdreceive_bpf_client2_t fdreceivebpfdomain; +typeattribute test_fdreceive_bpf_client2_t testdomain; +allow test_fdreceive_bpf_client2_t test_fdreceive_file_t:file { rw_file_perms }; +allow test_fdreceive_bpf_client2_t test_file_t:sock_file { rw_sock_file_perms }; +allow test_fdreceive_bpf_client2_t test_fdreceive_server_t:unix_stream_socket { connectto }; +allow test_fdreceive_bpf_client2_t self:bpf { prog_load prog_run }; +allow test_fdreceive_bpf_client2_t self:capability { sys_resource }; +allow test_fdreceive_bpf_client2_t self:process { setrlimit }; +# Server side rules: +allow test_fdreceive_server_t test_fdreceive_bpf_client2_t:fd { use }; + +# Domain for bpf client3 process - Removes BPF map_read perm from server. +# Tests security_file_receive flow. +type test_fdreceive_bpf_client3_t; +domain_type(test_fdreceive_bpf_client3_t) +unconfined_runs_test(test_fdreceive_bpf_client3_t) +typeattribute test_fdreceive_bpf_client3_t fdreceivebpfdomain; +typeattribute test_fdreceive_bpf_client3_t testdomain; +allow test_fdreceive_bpf_client3_t test_fdreceive_file_t:file { rw_file_perms }; +allow test_fdreceive_bpf_client3_t test_file_t:sock_file { rw_sock_file_perms }; +allow test_fdreceive_bpf_client3_t test_fdreceive_server_t:unix_stream_socket { connectto }; +allow test_fdreceive_bpf_client3_t self:bpf { map_create map_read map_write }; +allow test_fdreceive_bpf_client3_t self:capability { sys_resource }; +allow test_fdreceive_bpf_client3_t self:process { setrlimit }; +# Server side rules: +allow test_fdreceive_server_t test_fdreceive_bpf_client3_t:fd { use }; +allow test_fdreceive_server_t test_fdreceive_bpf_client3_t:bpf { map_write }; + +# Allow all of these domains to be entered from the sysadm domain. +miscfiles_domain_entry_test_files(fdreceivebpfdomain) +userdom_sysadm_entry_spec_domtrans_to(fdreceivebpfdomain) diff --git a/tests/bpf/Makefile b/tests/bpf/Makefile index 46817a5..3513179 100644 --- a/tests/bpf/Makefile +++ b/tests/bpf/Makefile @@ -2,9 +2,16 @@ TARGETS = bpf_test DEPS = bpf_common.c bpf_common.h LDLIBS += -lselinux -lbpf +# export so that BPF_ENABLED entries get built correctly on local build +export CFLAGS += -DHAVE_BPF + +BPF_ENABLED = ../fdreceive + all: $(TARGETS) + @set -e; for i in $(BPF_ENABLED); do $(MAKE) -C $$i all ; done clean: rm -f $(TARGETS) + @set -e; for i in $(BPF_ENABLED); do $(MAKE) -C $$i clean ; done $(TARGETS): $(DEPS) diff --git a/tests/bpf/test b/tests/bpf/test index ee00a19..36f1f32 100755 --- a/tests/bpf/test +++ b/tests/bpf/test @@ -4,8 +4,10 @@ use Test::More; BEGIN { $basedir = $0; $basedir =~ s|(.*)/[^/]*|$1|; + $fdr_basedir = "$basedir/../fdreceive/"; - $test_count = 7; + $test_count = 7; + $test_fdreceive = 0; # allow info to be shown during tests $v = $ARGV[0]; @@ -18,6 +20,14 @@ BEGIN { $v = " "; } + # Test if fdreceive is BPF enabled + $result = system("$fdr_basedir/client -t $basedir/test_sock 2>/dev/null"); + + if ( $result >> 8 eq 0 ) { + $test_fdreceive = 1; + $test_count += 4; + } + plan tests => $test_count; } @@ -61,4 +71,47 @@ $result = system "runcon -t test_bpf_deny_prog_run_t $basedir/bpf_test -p $v 2>&1"; ok($result); +if ($test_fdreceive) { + # + ################ BPF Tests for fdreceive ####################### + # + # Remove any leftover test file from prior failed runs. + system("rm -rf $basedir/test_sock"); + + # Start server process in test_fdreceive_server_t. + system("mkfifo $basedir/flag"); + if ( ( $pid = fork() ) == 0 ) { + exec +"runcon -t test_fdreceive_server_t $fdr_basedir/server $basedir/flag $basedir/test_sock"; + } + + # Wait for it to initialize. + system("read -t 5 <>$basedir/flag"); + + # Test BPF map & prog fd on transfer: + $result = system +"runcon -t test_fdreceive_bpf_client_t -- $fdr_basedir/client -m $basedir/test_sock"; + ok( $result eq 0 ); + + $result = system +"runcon -t test_fdreceive_bpf_client_t -- $fdr_basedir/client -p $basedir/test_sock"; + ok( $result eq 0 ); + + # Remove BPF prog_run permission from server: + $result = system +"runcon -t test_fdreceive_bpf_client2_t -- $fdr_basedir/client -p $basedir/test_sock"; + ok($result); + + # Remove BPF map_read permission from server: + $result = system +"runcon -t test_fdreceive_bpf_client3_t -- $fdr_basedir/client -m $basedir/test_sock"; + ok($result); + + # Kill the server. + kill KILL, $pid; + + # Clean up. + system "rm -rf $basedir/test_sock $basedir/flag"; +} + exit; diff --git a/tests/fdreceive/Makefile b/tests/fdreceive/Makefile index bc33f1b..895f91c 100644 --- a/tests/fdreceive/Makefile +++ b/tests/fdreceive/Makefile @@ -1,3 +1,13 @@ -all: client server +TARGETS = client server + +ifneq (,$(findstring -DHAVE_BPF,$(CFLAGS))) + DEPS = ../bpf/bpf_common.c ../bpf/bpf_common.h + LDLIBS += -lbpf +endif + +all: $(TARGETS) + clean: - rm -f client server + rm -f $(TARGETS) + +client: $(DEPS) diff --git a/tests/fdreceive/client.c b/tests/fdreceive/client.c index de40bc7..770cc99 100644 --- a/tests/fdreceive/client.c +++ b/tests/fdreceive/client.c @@ -8,11 +8,29 @@ #include #include +#if HAVE_BPF +#include "../bpf/bpf_common.h" +#endif + +static void usage(char *progname) +{ + fprintf(stderr, + "usage: %s [-m|-p|t] [file] addr\n" + "\nWhere:\n\t" + "-m Create BPF map fd\n\t" + "-p Create BPF prog fd\n\t" + "-t Test if BPF enabled\n\t" + " If -m or -p not supplied, create a file fd using:\n\t" + "file Test file fd sent to server\n\t" + "addr Servers address\n", progname); + exit(-1); +} + int main(int argc, char **argv) { struct sockaddr_un sun; - char buf[1024]; - int s, sunlen, ret, buflen; + char buf[1024], *addr = NULL; + int opt, s, sunlen, ret, buflen; struct msghdr msg = { 0 }; struct iovec iov; struct cmsghdr *cmsg; @@ -20,15 +38,71 @@ int main(int argc, char **argv) char cmsgbuf[CMSG_SPACE(sizeof myfd)]; int *fdptr; - if (argc != 3) { - fprintf(stderr, "usage: %s testfile address\n", argv[0]); - exit(-1); + enum { + FILE_FD, + MAP_FD, + PROG_FD, + BPF_TEST + } client_fd_type; + + client_fd_type = FILE_FD; + + while ((opt = getopt(argc, argv, "mpt")) != -1) { + switch (opt) { + case 'm': + client_fd_type = MAP_FD; + break; + case 'p': + client_fd_type = PROG_FD; + break; + case 't': + client_fd_type = BPF_TEST; + break; + } } - myfd = open(argv[1], O_RDWR); - if (myfd < 0) { - perror(argv[1]); + if ((client_fd_type == FILE_FD && (argc - optind) != 2) || + (client_fd_type > FILE_FD && (argc - optind) != 1)) + usage(argv[0]); + + switch (client_fd_type) { + case FILE_FD: + myfd = open(argv[optind], O_RDWR); + if (myfd < 0) { + perror(argv[optind]); + exit(-1); + } + + addr = argv[optind + 1]; + printf("client: Using a file fd\n"); + break; +#if HAVE_BPF + case MAP_FD: + /* If BPF enabled, then need to set limits */ + bpf_setrlimit(); + addr = argv[optind]; + myfd = create_bpf_map(); + printf("client: Using a BPF map fd\n"); + break; + case PROG_FD: + bpf_setrlimit(); + addr = argv[optind]; + myfd = create_bpf_prog(); + printf("client: Using a BPF prog fd\n"); + break; + case BPF_TEST: + exit(0); + break; +#else + case MAP_FD: + case PROG_FD: + case BPF_TEST: + fprintf(stderr, "BPF not supported by Client\n"); exit(-1); + break; +#endif + default: + usage(argv[0]); } s = socket(AF_UNIX, SOCK_STREAM, 0); @@ -38,7 +112,8 @@ int main(int argc, char **argv) } sun.sun_family = AF_UNIX; - strcpy(sun.sun_path, argv[2]); + strcpy(sun.sun_path, addr); + sunlen = strlen(sun.sun_path) + 1 + sizeof(short); ret = connect(s, (struct sockaddr *)&sun, sunlen); if (ret < 0) {